PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11467.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 571aa    MW: 63613.4 Da    PI: 4.2421
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11467.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.5e-5491371129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv++yLk+kv gk++++ + i+ vdiyk+ePwdLp k k+k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd+++ + k++
  PK11467.1   9 LAPGFRFHPTDEELVSYYLKRKVCGKPVRV-DPISVVDIYKTEPWDLPgKsKLKSRDLEWYFFSALDKKYGNGWRTNRATEKGYWKTTGKDRPINH-KSR 106
                579***************************.89***************6347777888**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                +vg+kktLvf++grapkg +t+Wvmheyrle
  PK11467.1 107 TVGMKKTLVFHTGRAPKGDRTNWVMHEYRLE 137
                *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-636159IPR003441NAC domain
PROSITE profilePS5100558.3249159IPR003441NAC domain
PfamPF023651.2E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MGRKSSTSLA PGFRFHPTDE ELVSYYLKRK VCGKPVRVDP ISVVDIYKTE PWDLPGKSKL  60
KSRDLEWYFF SALDKKYGNG WRTNRATEKG YWKTTGKDRP INHKSRTVGM KKTLVFHTGR  120
APKGDRTNWV MHEYRLEDEE LKNVGIQQDA FVLCRIFQKS GTGPKNGEQY GAPFIEEEWE  180
DDEVPTGEEV QTGEVVLGDG AFVDVIESNQ TFGTVAPSGI GALPLNIHHE DANNYLQNIG  240
DLAEDAPSEV APPPAFYYGE TSNYVEHSGD YAEDGSKPII GSETSDLGER ENLFELPGQY  300
AMNTPVKDEY YVQPNISQNP NPAEEYFVLP SNNGNPVDVD YSLGEQYLDA ADSLPFDEGL  360
YLETNDLSNP IEANPAEFDI LDEYLNYFDA NEDISQYLDF DMWTENNVTE EGLPLQTPVT  420
GEPEADPIGT KQCLEEHTDT SGASSSNQKA DVKFEPDFKY QFSKQASQML GSIPAPPAFA  480
AEFPTKDATL LSSVAQSSNS VHVTAAMIRI RNLRVDGDRM GWSYGKNDNV DIFLSDLSSA  540
SMVSMVPMAD TLSGKAASVV TKGLFWFLFI W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-47415910168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090439.10.0NAC domain-containing protein 78
TrEMBLW9QKP70.0W9QKP7_9R
STRINGPOPTR_0010s23650.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-143NAC domain containing protein 2